OPUNC01G21940.1 (PRGDB293598)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB293598	OPUNC01G21940.1	L	putative	LRR	Oryza punctata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
TRIUR3_27366-P1	Triticum urartu	79.4	34	8e-13
OBART11G23140.1	Oryza barthii	57.9	57	2e-12
Traes_6BL_E7E14C446.1	Triticum aestivum	52.6	57	3e-12
BGIOSGA001276-PA	Oryza sativa Indica Group	57.9	57	3e-12
Traes_6BL_C99521B9E.1	Triticum aestivum	76.5	34	3e-12
OBART01G21790.1	Oryza barthii	81.1	37	7e-12
Traes_6BL_2800857DE.1	Triticum aestivum	52.6	57	8e-12
OMERI01G20050.1	Oryza meridionalis	57.9	57	1e-11
ONIVA01G25000.1	Oryza nivara	57.9	57	1e-11
TRIUR3_17471-P1	Triticum urartu	62	50	1e-11

Showing 1 to 10 of 170 entries

Protein sequence

MSYNNLSGVMPSGLQLQTFDNQIYIYVGNPGLCGISLPWDGHRICSGYKLDSLGAKNTRRCSMKSLCLLP
VNYSQLVSKYLITQ