892687 (PRGDB29727)

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29727	892687	T	putative	TM, TIR	Arabidopsis lyrata

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
AT1G54470.1	Arabidopsis thaliana	74.8	107	7e-47
AT1G54470.2	Arabidopsis thaliana	74.8	107	3e-45
RPP27	Arabidopsis thaliana	74.8	107	6e-45
Araha.16970s0001.1.p	Arabidopsis halleri	85.3	109	1e-42

Showing 1 to 4 of 4 entries

MTTTFVLFLLLLCVFAINPSQQEEINQQNPGIYHQKLLYKVQQWRTALKESNAAELKISSAIIVVGGLCF
LVALISSACVIGGRGLFIPIMTTAARLDLKTAPSFSGIRNRC