920251 (PRGDB29732)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29732	920251	T	putative	TM, TIR	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
916988	Arabidopsis lyrata	99.9	147	2e-99
Araha.25564s0001.1.p	Arabidopsis halleri	96.5	145	1e-94
856004	Arabidopsis lyrata	94.8	116	5e-76
Araha.4174s0002.1.p	Arabidopsis halleri	60.6	142	3e-34
916990	Arabidopsis lyrata	59	95	7e-18
Thhalv10001191m	Eutrema salsugineum	36.8	155	2e-17
Bostr.8819s0049.1.p	Babiana stricta	40.6	143	5e-17
Bostr.8819s0020.1.p	Babiana stricta	35.3	153	7e-15
AT5G45240.1	Arabidopsis thaliana	35.3	153	4e-14
Bostr.8819s0017.1.p	Babiana stricta	35	160	9e-12

Showing 1 to 10 of 405 entries

Protein sequence

MDNNSNDEAKHTVYISFNKNDSSVSSFISYLIAAFNRQGIISAFVDGKSSHDEAVEREMGPEEFSKLRVV
VVVFSKNYALHVSFLEKQILEYSYRNNNDFVVVPVFYGVSISSVNQHMERFGEEFDAIQRSRIKWRPGHE
YDCKRRYRL