884718 (PRGDB29747)

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29747	884718	T	putative	TIR	Arabidopsis lyrata

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
884974	Arabidopsis lyrata	99.9	147	4e-103
Araha.8608s0003.1.p	Arabidopsis halleri	80.1	146	4e-80
875865	Arabidopsis lyrata	78.5	144	4e-76
Thhalv10024056m	Eutrema salsugineum	74	146	1e-75
AT1G57830.1	Arabidopsis thaliana	74	146	1e-72
Bostr.25494s0026.1.p	Babiana stricta	72.7	143	7e-72
879163	Arabidopsis lyrata	72	143	9e-72
AT1G09665.1	Arabidopsis thaliana	72.7	143	3e-71
Araha.3403s0035.1.p	Arabidopsis halleri	72	143	4e-71
AT1G60320.1	Arabidopsis thaliana	76.7	146	2e-70

Showing 1 to 10 of 499 entries

MVFINFRGVELRHAFISHLVAAFEQHRINFFIDKDEQKGRDLKHLFKRIKESHIALAIFSRRYAQSKWCL
NELVKIKKLADNKKLKVVPIFYKVKVGDVRHQKGEFGRNFWKLAKASTGEEIKKWKEALEFVSSKMGLPL
GNKRYSS