858667 (PRGDB29754)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29754	858667	T	putative	TM, TIR	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Cagra.0629s0015.1.p	Conradina grandiflora	63	81	3e-29
AT3G51570.1	Arabidopsis thaliana	58.7	92	3e-29
485509	Arabidopsis lyrata	58.7	92	3e-29
356572	Arabidopsis lyrata	58.1	93	5e-29
Bo9g061320.1	Brassica oleracea	59	83	2e-28
Carubv10011501m	Capsella rubella	59.3	81	2e-28
AT1G51270.4	Arabidopsis thaliana	61.3	93	2e-28
856927	Arabidopsis lyrata	57	93	3e-28
AT1G51270.2	Arabidopsis thaliana	61.3	93	3e-28
AT1G51270.1	Arabidopsis thaliana	61.3	93	4e-28

Showing 1 to 10 of 499 entries

Protein sequence

MASSSILSIGLLPQDQVFINFRGDELRTSFVRRLTKAWKENGVNVFMDEHLNKGTPITKLFKKIEESRIA
LAIFSKRYSESKWCLDELVKINE