895867 (PRGDB29766)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29766	895867	T	putative	TM, TIR	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.21478s0010.1.p	Arabidopsis halleri	62.3	122	3e-39
Bostr.20129s0395.1.p	Babiana stricta	54.2	118	1e-32
Bostr.20129s0395.2.p	Babiana stricta	54.2	118	1e-32
Thhalv10024348m	Eutrema salsugineum	76.4	72	1e-29
Thhalv10026964m	Eutrema salsugineum	68.1	72	7e-27
Cagra.1361s0071.1.p	Conradina grandiflora	49.1	114	4e-23
Bostr.20129s0360.1.p	Babiana stricta	66.1	62	8e-20
MDP0000661138	Malus domestica	56	75	8e-19
Ciclev10024129m	Citrus clementina	59.1	66	2e-18
PGSC0003DMT400024930	Solanum tuberosum	56.1	66	4e-18

Showing 1 to 10 of 499 entries

Protein sequence

MAISLLYLAIVVFVGLRRLLQFLRKSEDSPSRSLWKYDVFLSFRGTDVRKSFVSHLYEALNNGGVKTFHD
DRELQKGTFIWEGLEKEIDQSRFATVNFKKFEIEHPLKRCRVNAKLCSFNHINLSVLKCKVGENKIESSS
TFVMMRSSERQNRRS