856467 (PRGDB29775)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29775	856467	N	putative	NBS	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
874330	Arabidopsis lyrata	99.5	191	1e-136
Bostr.7200s0053.1.p	Babiana stricta	69	197	4e-87
Bostr.7200s0050.1.p	Babiana stricta	69	197	1e-86
Bostr.13671s0391.1.p	Babiana stricta	69	197	7e-85
Bostr.13671s0391.2.p	Babiana stricta	69	197	7e-85
Araha.6034s0001.1.p	Arabidopsis halleri	66.5	197	2e-84
Bostr.19424s0015.1.p	Babiana stricta	68.5	197	8e-84
Bostr.25993s0382.1.p	Babiana stricta	66.5	197	1e-83
Bostr.7867s0935.1.p	Babiana stricta	67.5	197	1e-82
Bostr.18351s0417.1.p	Babiana stricta	66.3	196	2e-81

Showing 1 to 10 of 499 entries

Protein sequence

FLFEQYSNSFQLRAIMVNIKESYRQLGLDEKSAQLKLQSHMLSEMLNQKDIMVPNLGVAQERLKDKEIFL
VLDDVDRLEQLDALAKETRWFGPRSRIIITTQDLRVLEAHGINHIYKVDFPSTHEAFQMVCIYAFGQKNP
EYDFTELVWEVANLASQLPLGLKVMGSHFKRKSKQEWKNALPSLKNRLHADIVSVLK