893401 (PRGDB29823)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29823	893401	L	putative	LRR	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
338250	Arabidopsis lyrata	64.5	217	1e-77
Bostr.10040s0072.1.p	Babiana stricta	65.7	204	2e-76
Bostr.10040s0071.2.p	Babiana stricta	64.7	204	3e-76
Bostr.10040s0071.1.p	Babiana stricta	64.7	204	2e-75
Thhalv10023260m	Eutrema salsugineum	66.3	205	3e-74
Thhalv10023248m	Eutrema salsugineum	66.3	205	4e-74
Cagra.0982s0007.3.p	Conradina grandiflora	66.2	204	6e-74
Cagra.0982s0007.2.p	Conradina grandiflora	66.2	204	6e-74
Cagra.0982s0007.1.p	Conradina grandiflora	66.2	204	6e-74
Bostr.10040s0078.1.p	Babiana stricta	65.2	204	3e-72

Showing 1 to 10 of 499 entries

Protein sequence

MALWIASYFGKQKETFIVQARVGLHEIPKVKDWGTVRRMSLMNNDIEEITCGSKCSELTTLFLQENQLKN
HSGEFIQSMQKLAVLDLSEQLPVGFQELKKLAHLNLASTERLCSIGGISKLSSLKILKLRNSKVHIDGSL
VKELQLLEHLQVLTITITDLAWELLLGDERLANCINMSANSRIPTKAI