906770 (PRGDB29849)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB29849	906770	RLP	putative	TM, LRR	Arabidopsis lyrata

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
344577	Arabidopsis lyrata	98.2	109	3e-70
347425	Arabidopsis lyrata	96.4	112	2e-69
476729	Arabidopsis lyrata	66.2	148	5e-50
AT1G75820.1	Arabidopsis thaliana	63.5	148	5e-49
Thhalv10018069m	Eutrema salsugineum	62.2	148	3e-47
Bostr.20129s0016.1.p	Babiana stricta	63.5	148	1e-46
Cagra.0799s0053.1.p	Conradina grandiflora	62.2	148	2e-46
Thecc1EG034252t1	Theobroma cacao	53.7	95	3e-24
Kalax.0183s0036.1.p	Kalanchoe marnieriana	40.4	156	7e-24
Gorai.005G112100.1	Gossypium raimondii	53.7	95	8e-24

Showing 1 to 10 of 499 entries

Protein sequence

MSGDVLDQIYLSNNWFSGEIPPAIGNFPNLQTLFLDRNRFRGNLPREIFELKHLSKINTSANNITGSIPT
RIGNMTSLTTLYLSFKDLSGRVPLGGQFMVSRFVGISGLMGQLIGLVSG