Phvul.006G188800.1 (PRGDB2107913)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2107913	Phvul.006G188800.1	T	putative	TIR	Phaseolus vulgaris

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Glyma.15G070400.1.p	Glycine max	86.2	181	5e-113
Glyma.13G243000.1.p	Glycine max	87.4	174	1e-110
Glyma.07G193000.1.p	Glycine max	80.6	180	1e-104
Medtr4g089115.1	Medicago truncatula	80.7	166	3e-95
Manes.16G024000.1.p	Manihot esculenta	70.4	169	6e-87
Potri.011G046800.1	Populus trichocarpa	68.2	173	1e-86
Potri.004G038200.1	Populus trichocarpa	68.3	167	3e-82
Ciclev10018304m	Citrus clementina	69	168	5e-82
orange1.1g046164m	Citrus sinensis	67	173	1e-81
Manes.17G042000.1.p	Manihot esculenta	69.6	171	2e-81

Showing 1 to 10 of 499 entries

Protein sequence

MQRLPAKLMAKMGRPACDVFINHRGIDTKRNVAGLLYDNLTRMGVRSFLDSMNMKPGDRLFHNIDRGILG
CKVGVAVFSPRYCDSHFCLHELALLMESNKRVVPIFYDVKPSELRVKDNGTCPPMELQRFAFALEEAKNT
VGLTFDSLNGDWSKLLRNASEAVIVNLLEVEEERKHARKQR