Phvul.009G210300.1 (PRGDB2109703)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2109703	Phvul.009G210300.1	N	putative	NBS	Phaseolus vulgaris

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Glyma.01G158800.3.p	Glycine max	89	191	1e-122
Glyma.01G158800.1.p	Glycine max	89	191	1e-122
VIT_04s0044g00120.t01	Vitis vinifera	79.2	192	2e-104
Ciclev10026547m	Citrus clementina	75.9	191	2e-101
Manes.01G155400.1.p	Manihot esculenta	77	191	5e-101
orange1.1g029421m	Citrus sinensis	75.4	191	3e-100
29830.m001449	Ricinus communis	72.9	192	4e-98
mrna13042.1-v1.0-hybrid	Fragaria vesca	74.9	191	4e-97
Glyma.01G158800.2.p	Glycine max	89.5	153	2e-95
Eucgr.I02225.1.p	Eucalyptus grandis	72.9	192	4e-95

Showing 1 to 10 of 59 entries

Protein sequence

MAGPGKCFLVTGPPGVGKTTLIMRVLESLSANSSIKLQGFYTREVRRAGQRVGFEVVTLDARTAPLASLH
FSTPESHGWPSVGKYKVDVASFESLALPELQVREDTSLFIIDEVGKMELFSSSFFPAVLRVLESNIPVLA
SIPVPKFGRDIPEVARLRNHAGATCFTLNVANRDAVREQIRSLLEDLLIKH