Glyma.01G158800.3.p (PRGDB241152)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB241152	Glyma.01G158800.3.p	N	putative	NBS	Glycine max

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Glyma.01G158800.1.p	Glycine max	99.9	191	1e-137
Phvul.009G210300.1	Phaseolus vulgaris	89	191	1e-122
Manes.01G155400.1.p	Manihot esculenta	83.2	191	1e-110
VIT_04s0044g00120.t01	Vitis vinifera	81.2	192	2e-110
29830.m001449	Ricinus communis	79.2	192	3e-108
Glyma.01G158800.2.p	Glycine max	99.9	153	1e-106
Ciclev10026547m	Citrus clementina	78.5	191	4e-106
mrna13042.1-v1.0-hybrid	Fragaria vesca	79.6	191	1e-105
orange1.1g029421m	Citrus sinensis	78.5	191	1e-105
Eucgr.I02225.1.p	Eucalyptus grandis	78.1	192	2e-103

Showing 1 to 10 of 59 entries

Protein sequence

MAGPGKCFLVTGPPGVGKTTLIMKVFESLKVNPSLKLQGFYTREIRRAGQRVGFEVVTLDGRTAPLASID
ISTPESLRWPNVGKYKVDVASFESLALPELQVKEDTDLFIIDEVGKMELFSSSFFPAVLRVLESNIPVLA
SIPVPKFGRDIPEVARLRNHAGATCFTLSVSNRDAVREQIRSQLEDMLTKH