Pp3c9_24950V3.1.p (PRGDB2110112)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110112	Pp3c9_24950V3.1.p	N	putative	NBS, TM	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c17_8750V3.1.p	Physcomitrella patens	67.3	205	9e-87
Pp3c13_19900V3.1.p	Physcomitrella patens	57.5	219	6e-77
Pp3c13_15200V3.2.p	Physcomitrella patens	57.1	219	1e-73
Pp3c17_20880V3.2.p	Physcomitrella patens	57.4	216	9e-72
Pp3c13_15270V3.2.p	Physcomitrella patens	57.1	219	9e-72
Pp3c13_15200V3.1.p	Physcomitrella patens	57.1	219	8e-71
Pp3c13_15270V3.1.p	Physcomitrella patens	57.1	219	1e-70
Pp3c21_15570V3.2.p	Physcomitrella patens	58.8	216	2e-70
Pp3c16_23160V3.2.p	Physcomitrella patens	56.2	219	2e-70
Pp3c16_23160V3.1.p	Physcomitrella patens	56.2	219	2e-70

Showing 1 to 10 of 200 entries

Protein sequence

MNGASCFIEFSESGGDCFTISCKIFEELKEKSKSKDIEEAQDMLKSFFTKNKIILVLFYVKKQSQIKDIM
ALDVLIFWYRIYKINVEELDEETSMRLFITHSCGNQETLPNELVEVGNEITKACNTLSLSLNDMDAFLRR
QHRLRCQKGALQRLKRGRDLNRDESNSDHKIWNILRINFDNLKDKEKNMLLDICCLFGSD