Pp3c17_8750V3.1.p (PRGDB2113110)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113110	Pp3c17_8750V3.1.p	N	putative	NBS	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c13_19900V3.1.p	Physcomitrella patens	61.5	231	1e-91
Pp3c9_24950V3.1.p	Physcomitrella patens	67.3	205	1e-86
Pp3c17_20880V3.2.p	Physcomitrella patens	59.3	231	4e-83
Pp3c21_15570V3.2.p	Physcomitrella patens	60.2	231	7e-82
Pp3c13_15200V3.2.p	Physcomitrella patens	58.4	231	1e-81
Pp3c21_15570V3.1.p	Physcomitrella patens	60.2	231	2e-81
Pp3c18_4530V3.2.p	Physcomitrella patens	58.9	231	4e-81
Pp3c18_4530V3.1.p	Physcomitrella patens	58.9	231	3e-80
Pp3c17_20870V3.1.p	Physcomitrella patens	59.3	231	9e-80
Pp3c17_20880V3.1.p	Physcomitrella patens	59.3	231	9e-80

Showing 1 to 10 of 499 entries

Protein sequence

MFGASCFIECSESGVDCFTISCKILEQLNEKSKPKDIEEAQDMLKSFFIKNKIILVLDDVKEQSQIEDIV
AMDALSKSIAHFGVEFVKINIHELDEETSMRFFITHSYGYQETLPNELVEVGNEIIKSCNGIPLSLKIMD
VFLSSQKRLKKRRDLDGDKSNTDHKIWDILKVSFDNLKNEEKSMFLDICCFFGSDVCLQGMLKERAL