Pp3c20_4130V3.1.p (PRGDB2110118)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2110118	Pp3c20_4130V3.1.p	N	putative	NBS, TM	Physcomitrella patens

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Pp3c17_8750V3.1.p	Physcomitrella patens	55.9	93	5e-28
Pp3c13_2900V3.1.p	Physcomitrella patens	52.4	103	4e-24
Pp3c13_2910V3.1.p	Physcomitrella patens	52.4	103	9e-24
Pp3c13_3150V3.1.p	Physcomitrella patens	50.5	103	8e-23
Pp3c13_19900V3.1.p	Physcomitrella patens	50.5	103	1e-22
Pp3c16_23160V3.2.p	Physcomitrella patens	50.5	103	2e-22
Pp3c16_23160V3.1.p	Physcomitrella patens	50.5	103	2e-22
Pp3c13_2610V3.1.p	Physcomitrella patens	49.5	103	1e-21
Pp3c13_2610V3.2.p	Physcomitrella patens	49.5	103	2e-21
Pp3c7_17410V3.1.p	Physcomitrella patens	53.3	90	3e-21

Showing 1 to 10 of 101 entries

Protein sequence

LNEDTSLKLFITHFYGYQDKFSNKFDDIGKYIVKACNGLSLNLKVMDVILSRQKRRSDLDGYKNNSDYKI
LNILKISFNSLMKVEEKNMF