AT2G17055.1 (PRGDB211210)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB211210	AT2G17055.1	T	putative	TM, TIR	Arabidopsis thaliana

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.30275s0433.1.p	Babiana stricta	38.8	121	1e-15
323710	Arabidopsis lyrata	44.6	112	1e-14
Araha.7760s0001.1.p	Arabidopsis halleri	39.4	132	2e-14
Thhalv10010075m	Eutrema salsugineum	43.3	104	4e-14
917000	Arabidopsis lyrata	37.4	131	1e-13
AT3G51560.1	Arabidopsis thaliana	39	118	2e-13
Araha.5635s0002.1.p	Arabidopsis halleri	35.9	131	3e-12
Prupe.8G108700.1.p	Prunus persica	35.6	149	5e-12
Prupe.8G108500.1.p	Prunus persica	35.3	150	3e-11
AT4G19520.1	Arabidopsis thaliana	36.3	135	3e-11

Showing 1 to 10 of 391 entries

Protein sequence

MTYMVYISFHKGEDRIRYSFLSHLSASLRRKGLISSSSFVHHSSNEIKIEKTKFKAFLVVISWKYVLSAE
CLDELAEIADQNVVVPVFYCITQSDVKHQCRLDILRDTFPLEDYSAERVSRWIYALNKTTKSYKLR