Prupe.8G108700.1.p (PRGDB2117984)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2117984	Prupe.8G108700.1.p	T	putative	TIR	Prunus persica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.8G109200.1.p	Prunus persica	94.3	157	4e-98
Prupe.8G108500.1.p	Prunus persica	93	157	3e-97
Prupe.8G109500.1.p	Prunus persica	90.5	157	1e-94
Prupe.8G109000.1.p	Prunus persica	90.1	152	1e-92
Prupe.2G088600.1.p	Prunus persica	73	148	2e-73
MDP0000309329	Malus domestica	70.8	147	2e-71
Prupe.2G068400.1.p	Prunus persica	71	148	4e-71
mrna24403.1-v1.0-hybrid	Fragaria vesca	68.9	148	4e-71
Prupe.8G110600.1.p	Prunus persica	73	152	6e-71
mrna31994.1-v1.0-hybrid	Fragaria vesca	69.4	147	8e-71

Showing 1 to 10 of 499 entries

Protein sequence

MTYDVFLSFRGEDTRFNFTDHLYSNLTRKGIRTFIDDGLKRGEEISRALLRAIEESKTSIIVFSENYASS
KWCLDELVKILESKETREQMVWPVFYKVNPSDVRHQRGSFGQALADYECEFKDDMEKVQRWRRSLTKAAN
LSGWCFINGVEANLKDH