Potri.008G076200.1 (PRGDB2113439)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2113439	Potri.008G076200.1	T	putative	TIR	Populus trichocarpa

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
VIT_18s0117g00070.t01	Vitis vinifera	63.8	47	4e-14
MDP0000136726	Malus domestica	48.4	62	5e-13
Prupe.7G017000.1.p	Prunus persica	60.5	43	3e-12
Solyc11g011090.1.1	Solanum lycopersicum	72.5	40	6e-12
Potri.013G096900.1	Populus trichocarpa	58	50	9e-12
Potri.013G097900.1	Populus trichocarpa	58	50	1e-11
MDP0000239575	Malus domestica	71	38	2e-11
Potri.013G098500.2	Populus trichocarpa	58	50	2e-11
29747.m001050	Ricinus communis	54	50	2e-11
VIT_18s0117g00360.t01	Vitis vinifera	58	50	2e-11

Showing 1 to 10 of 499 entries

Protein sequence

MLCHYVFNFYTTEACKLFFMATRDIEQASSSASSSSSRKWRYDVFLNFRGKDTRKNFTDHLYAALLGRGS
RY