Prupe.8G053200.2.p (PRGDB2117969)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2117969	Prupe.8G053200.2.p	T	putative	TIR	Prunus persica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.8G053200.1.p	Prunus persica	99.9	85	5e-57
Prupe.8G034700.1.p	Prunus persica	91.8	85	6e-49
Prupe.8G032000.1.p	Prunus persica	89.4	85	4e-48
Prupe.8G053300.7.p	Prunus persica	94.1	85	1e-47
Prupe.8G053300.4.p	Prunus persica	94.1	85	1e-47
Prupe.8G031800.2.p	Prunus persica	92.9	85	2e-47
Prupe.8G053300.2.p	Prunus persica	94.1	85	1e-46
Prupe.8G053300.3.p	Prunus persica	94.1	85	1e-46
Prupe.8G053300.5.p	Prunus persica	94.1	85	1e-46
Prupe.8G053300.6.p	Prunus persica	94.1	85	1e-46

Showing 1 to 10 of 499 entries

Protein sequence

MALRTQRDSAFLPSPDQSAPQPNHDVFLSFRGEDTRLSFVSHLYHELQLRGIKTFKDDPKLERGTPISSE
LCNAIEESRFAIVVL