Prupe.2G112700.1.p (PRGDB2117975)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2117975	Prupe.2G112700.1.p	T	putative	TIR	Prunus persica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.2G113200.1.p	Prunus persica	99.9	152	2e-103
Prupe.8G044400.1.p	Prunus persica	87.3	158	3e-89
Prupe.8G032000.1.p	Prunus persica	79.6	162	2e-86
Prupe.8G041000.1.p	Prunus persica	88	158	6e-86
Prupe.8G044300.4.p	Prunus persica	86.1	158	3e-85
Prupe.8G044300.3.p	Prunus persica	86.1	158	3e-85
Prupe.8G044300.2.p	Prunus persica	86.1	158	3e-85
Prupe.8G044300.1.p	Prunus persica	86.1	158	3e-85
Prupe.6G160100.1.p	Prunus persica	80.4	158	3e-79
Prupe.8G053300.7.p	Prunus persica	80.4	158	9e-76

Showing 1 to 10 of 499 entries

Protein sequence

MRSFRYIEEIKEPVERECPGAVSCSADQSAPPQWNYDVFLSFRGVDTRNSFLSHLYHELQHRCIKTFMDD
PKLERGTTISSELFKAIQESRLAIVVLSPNYASSSWCLDELTNNLQCMKSNDTVLPMFFNVDPSDVRIQS
GIFAGAFAEHEKRFREDIEKVKRWRAALTEVANLSGFNSKNE