Prupe.2G068400.1.p (PRGDB2117982)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2117982	Prupe.2G068400.1.p	T	putative	TIR	Prunus persica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.2G057800.1.p	Prunus persica	92.6	149	3e-89
Prupe.2G057800.2.p	Prunus persica	92.6	149	4e-89
Prupe.2G057800.3.p	Prunus persica	92.6	149	4e-89
Prupe.2G088600.1.p	Prunus persica	78.7	150	4e-80
Prupe.2G057100.1.p	Prunus persica	82.8	157	4e-80
Prupe.2G056100.1.p	Prunus persica	82.2	152	2e-75
Prupe.2G057600.3.p	Prunus persica	74.4	168	6e-74
Prupe.2G057600.5.p	Prunus persica	74.4	168	6e-74
Prupe.2G057600.1.p	Prunus persica	74.4	168	6e-74
Prupe.2G055700.1.p	Prunus persica	79.7	153	1e-72

Showing 1 to 10 of 499 entries

Protein sequence

CPSPSPSSSSSSFTHDSSRTYDVFLSYRGEDTRTNFTDHLHEALVRKGIRTFIDRELVRGEEISPALVKA
IVESRISIIVFSENYASSRWCLDELVKILQCKESKQQIVLPFFYKVDPSDVRHQRSSYGDAFVHHERKFK
DDKEKVLKWRRALPEAANLSGWHFKEGDCRALCLI