Prupe.2G088600.1.p (PRGDB2117983)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2117983	Prupe.2G088600.1.p	T	putative	TIR	Prunus persica

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Prupe.2G068400.1.p	Prunus persica	78.7	150	1e-80
Prupe.2G057800.2.p	Prunus persica	79.2	149	9e-75
Prupe.2G057800.3.p	Prunus persica	79.2	149	9e-75
Prupe.2G057800.1.p	Prunus persica	79.2	149	1e-74
Prupe.8G108700.1.p	Prunus persica	73	148	5e-74
MDP0000309329	Malus domestica	67.5	169	2e-72
MDP0000295586	Malus domestica	73.2	149	4e-72
mrna32631.1-v1.0-hybrid	Fragaria vesca	64.8	162	1e-70
MDP0000190736	Malus domestica	66.7	168	6e-70
Prupe.8G109200.1.p	Prunus persica	71.1	159	8e-70

Showing 1 to 10 of 499 entries

Protein sequence

MRKHSSPPSPSFPTSSSSSSSSSSSFFTQSWTYDVFLSYRGEDTRKTFIDHLYTALDRQGIHTFIDDELP
RGEEISPALLNAIEESKISVIVFSENYASSSWCLDELVKILEYKKSKQQLVMPIFYKVDPSDVRNQRSSF
GDALVDHEHKFKDDMEKVLEWRRALTEAANLSGLHFKEGGT