Bostr.8819s0036.1.p (PRGDB212928)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB212928	Bostr.8819s0036.1.p	T	putative	TIR	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.8819s0034.1.p	Babiana stricta	81.9	105	2e-46
Thhalv10001160m	Eutrema salsugineum	70.4	108	1e-45
Thhalv10001159m	Eutrema salsugineum	68.4	95	2e-38
Bostr.8819s0041.1.p	Babiana stricta	58.1	93	1e-29
879163	Arabidopsis lyrata	58.3	84	6e-28
Bostr.8819s0022.1.p	Babiana stricta	58.1	93	2e-27
Carubv10017816m	Capsella rubella	58.5	82	2e-27
Araha.3403s0035.1.p	Arabidopsis halleri	57.1	84	4e-27
Bostr.25463s0314.2.p	Babiana stricta	51	100	4e-27
Bostr.25463s0314.1.p	Babiana stricta	51	100	4e-27

Showing 1 to 10 of 499 entries

Protein sequence

MDVYSLQLRSAKHQVLVNFQGVELWCSFVSHIVEALQSHRINVFIDKVERLGEELTNLFMRIEESTIAFV
IFSRSYTESKWCLDDLVKIKQRTDQGLVKSRDIVFNFDFLPFGTEAFPSSPASTCFLLVMRLQMRLPMKV
HHLLEYLIDVDVALGVEEDILRTCGGFK