Bostr.0556s0150.1.p (PRGDB212931)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB212931	Bostr.0556s0150.1.p	T	putative	TIR	Babiana stricta

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.28243s0030.1.p	Babiana stricta	91.4	197	2e-129
Bostr.28243s0034.1.p	Babiana stricta	91.2	194	1e-126
Bostr.0556s0151.1.p	Babiana stricta	81.7	219	4e-125
Bostr.11774s0003.1.p	Babiana stricta	80.3	218	4e-123
Bostr.0556s0145.1.p	Babiana stricta	82	189	2e-104
Bostr.0556s0154.1.p	Babiana stricta	77.9	199	2e-101
Bostr.26833s0460.1.p	Babiana stricta	78.8	189	1e-99
Cagra.10022s0001.1.p	Conradina grandiflora	73	200	2e-96
Carubv10018648m	Capsella rubella	72.7	198	2e-95
Cagra.2161s0001.1.p	Conradina grandiflora	71.3	202	9e-94

Showing 1 to 10 of 499 entries

Protein sequence

MRIAVSPGKVHQVFLNFRGEQLRYNFVSHLSDAFQKHEIKFFIDKYEQRGQDLKHLFFRIEESSIALAIF
STRYPESSWCMDELVKMKKLADQGKLRLVPIFYKVEAEDVRKPTSDSEFGKNFWRLAEASSGDQIKNWKE
ALECISDKMGLSLGDKRYTNFGNSEADFVKEIVKDVQRVIEAIGIEEEENHGGKIKEK