Solyc02g032250.1.1 (PRGDB2133587)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2133587	Solyc02g032250.1.1	T	putative	TIR	Solanum lycopersicum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
PGSC0003DMT400034080	Solanum tuberosum	90.6	64	1e-33
PGSC0003DMT400011504	Solanum tuberosum	94.1	51	1e-27
Solyc02g032640.1.1	Solanum lycopersicum	92.2	51	5e-27
Potri.005G004500.1	Populus trichocarpa	66.2	68	2e-24
Prupe.4G260800.1.p	Prunus persica	65.6	64	2e-24
Prupe.8G185300.1.p	Prunus persica	68.8	64	3e-24
MDP0000661138	Malus domestica	68.8	64	4e-24
MDP0000946278	Malus domestica	67.2	64	1e-23
MDP0000601632	Malus domestica	67.2	64	1e-23
Thecc1EG012501t1	Theobroma cacao	67.2	64	1e-23

Showing 1 to 10 of 499 entries

Protein sequence

MYYDVFMSFRGEDTRKTFTDQLYKALMDEGYQTFRDDNEIERGEDIKSELNKAIHSSKSSIFVLSKKLCN
V