Solyc02g032640.1.1 (PRGDB2133589)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2133589	Solyc02g032640.1.1	T	putative	TIR	Solanum lycopersicum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
PGSC0003DMT400011504	Solanum tuberosum	93.8	179	3e-107
PGSC0003DMT400034080	Solanum tuberosum	88.7	142	4e-91
Prupe.2G135700.1.p	Prunus persica	58.4	173	5e-58
Thecc1EG012501t1	Theobroma cacao	56.6	159	6e-58
Potri.011G014100.2	Populus trichocarpa	57.2	159	7e-58
Potri.011G014100.1	Populus trichocarpa	57.2	159	7e-58
PGSC0003DMT400047004	Solanum tuberosum	56.1	155	2e-57
mrna04796.1-v1.0-hybrid	Fragaria vesca	58.8	170	3e-57
Potri.T040100.1	Populus trichocarpa	58.6	157	1e-56
Potri.T039600.1	Populus trichocarpa	57.3	164	2e-56

Showing 1 to 10 of 499 entries

Protein sequence

MKGLRVEEASNVKSRCMYDVFMSFRGEDTRKTFTDELYKALVDEGYRTFRDDNEIERGEDIKSELDKAIH
SSKSSIIILSKNYATSSWCLDELVMILENKRKRGHAILPVFYYVDPLDVGKQMGSFATAFATHEQRIMEQ
SDDEGKEEKIKRWRAALREVADQSGSGMVLQSSSKE