Solyc05g024360.1.1 (PRGDB2133594)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2133594	Solyc05g024360.1.1	T	putative	TIR	Solanum lycopersicum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
PGSC0003DMT400043722	Solanum tuberosum	72.6	62	5e-28
PGSC0003DMT400008658	Solanum tuberosum	73.8	61	4e-27
PGSC0003DMT400025085	Solanum tuberosum	71	62	8e-25
PGSC0003DMT400006227	Solanum tuberosum	68.2	63	2e-23
N	Nicotiana glutinosa	70.5	61	3e-23
Glyma.14G152600.1.p	Glycine max	63.5	63	5e-23
PGSC0003DMT400080822	Solanum tuberosum	66.7	63	5e-23
PGSC0003DMT400047418	Solanum tuberosum	68.2	63	2e-22
Solyc11g011090.1.1	Solanum lycopersicum	72.9	59	4e-22
PGSC0003DMT400040557	Solanum tuberosum	67.7	62	5e-22

Showing 1 to 10 of 499 entries

Protein sequence

MNLKSIEESQVALVVFSKNYAKSRWFLDELLKILDSKTQYGQTVVPVFYDVDPSEVRNQKERFA