Glyma.14G152600.1.p (PRGDB236347)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB236347	Glyma.14G152600.1.p	T	putative	TM, TIR	Glycine max

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Glyma.01G032900.1.p	Glycine max	89.7	87	1e-48
Glyma.01G033200.1.p	Glycine max	90.8	87	3e-48
Glyma.01G033300.1.p	Glycine max	85.1	87	7e-45
Glyma.01G119800.1.p	Glycine max	76.1	88	2e-44
Phvul.002G323800.2	Phaseolus vulgaris	68.5	89	2e-36
Phvul.002G323800.3	Phaseolus vulgaris	68.5	89	2e-36
Phvul.002G323800.1	Phaseolus vulgaris	68.5	89	2e-36
Phvul.002G323300.1	Phaseolus vulgaris	69.7	89	7e-34
Phvul.007G160900.1	Phaseolus vulgaris	65.2	89	2e-33
Phvul.002G323100.1	Phaseolus vulgaris	62.9	89	8e-33

Showing 1 to 10 of 499 entries

Protein sequence

MNPIEHESNIDSIEESMIYVLVFSENYASSTWCLDELTKILDCKKRYGRVVIPVFYKVDPSIVRNQRETY
AEVFVKHEHQFEDKIDKVHAWKAAQTKACVSNSIKFIFVCVETFMCSFCVVLASHLKN