Traes_4BS_43BFC7653.2 (PRGDB2144342)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2144342	Traes_4BS_43BFC7653.2	TRAN	putative	TM	Triticum aestivum

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_4BS_43BFC7653.1	Triticum aestivum	99.9	209	9e-149
Traes_4AL_9D491EC88.2	Triticum aestivum	94.6	203	4e-122
Traes_4DS_A122BE00B.1	Triticum aestivum	88.1	202	4e-115
Traes_4BS_85552E6ED.1	Triticum aestivum	88.1	202	8e-113
EMT01754	Aegilops tauschii	88.1	202	4e-112
EMT06525	Aegilops tauschii	69.1	191	5e-86
Brast02G389400.1.p	Brachypodium stacei	58.4	221	2e-77
Brast02G389500.1.p	Brachypodium stacei	65.2	187	1e-72
EMT00177	Aegilops tauschii	72.5	142	1e-59
ACC81916.1		57.6	165	2e-57

Showing 1 to 10 of 21 entries

Protein sequence

MVEPRVYDQLGASAPRSGAHLSSDTKAVLCLGAATAVGWAAWRYYQRRACLRKFGRDMTAFAGKTDPVIG
RDDEIDRVVSILCRRTKNCVALVGAAGVGKTAVAEALAQRIAAGMVPDVLAGARVIELDVGALVAGTKWR
GSFERRMKDVIKQVEAADGKVILFIDEMHMLLGAGRSRKSANDAANMLKPALARGRIRCVGATTFDEYR