EMT00177 (PRGDB22137)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB22137	EMT00177	N	putative	NBS, TM	Aegilops tauschii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_4BS_43BFC7653.2	Triticum aestivum	72.5	142	5e-69
Traes_4BS_43BFC7653.1	Triticum aestivum	71.5	144	1e-67
Traes_4DS_A122BE00B.1	Triticum aestivum	70.4	142	2e-64
Traes_4AL_9D491EC88.2	Triticum aestivum	70.6	143	2e-64
EMT06525	Aegilops tauschii	72.5	142	4e-63
Brast02G389500.1.p	Brachypodium stacei	67.3	150	3e-62
EMT01754	Aegilops tauschii	70.4	142	6e-62
Traes_4BS_85552E6ED.1	Triticum aestivum	70.4	142	7e-62
Brast02G389400.1.p	Brachypodium stacei	66.7	150	4e-61
Bradi1g01040.2.p	Brachypodium distachyon	59.3	150	8e-49

Showing 1 to 10 of 21 entries

Protein sequence

MEQAMLARVLAVTSVDPVIGRDDDIDRIICILCRRTKNCAALVGPAGVGKTAIVEGLARRIAAGTVPEAL
VGARVAELDVGAMVAGTHWRGMFEQRLKDAIKKAEDSAGKLILFIDEMHMIVGAGDQRGGTGDAANILKP
ALARGRIRCIGATTTEEG