TRIUR3_33680-P1 (PRGDB2161998)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2161998	TRIUR3_33680-P1	RLP	putative	TM, LRR	Triticum urartu

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_2DL_44A3AB1E4.1	Triticum aestivum	76.7	219	6e-104
EMT26063	Aegilops tauschii	96.2	158	2e-103
Traes_2AL_34786C78C.1	Triticum aestivum	76.4	216	1e-100
Traes_2BL_754076A48.1	Triticum aestivum	95.9	146	2e-96
Brast09G124700.1.p	Brachypodium stacei	79.7	143	7e-74
Sevir.7G153400.1.p	Setaria viridis	75.9	145	9e-73
ONIVA04G14830.1	Oryza nivara	77.2	145	1e-70
Bradi5g13960.1.p	Brachypodium distachyon	76.9	143	2e-70
OGLUM04G16740.1	Oryza glumaepatula	76.5	145	9e-70
LOC_Os04g41030.1	Oryza sativa	76.5	145	9e-70

Showing 1 to 10 of 499 entries

Protein sequence

MSPLLLLLLALALPQALATQGPASETQEDDSRVLGLSLAGFGLQGTVPSALKYCRSTNTLDLSKNALEGP
IPPALCDWLPFLVVLDLSGNRFSGPLPSELANCRYLNSLKLSHNNFSGQIPASLSRLERLKSLDLSENRL
DGQIPPQLGATFPKESFSGNPGLCGRPVSSHCGRD