EMT26063 (PRGDB2163)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2163	EMT26063	RLP	putative	TM, LRR	Aegilops tauschii

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Traes_2DL_44A3AB1E4.1	Triticum aestivum	80.3	218	3e-111
TRIUR3_33680-P1	Triticum urartu	96.2	158	1e-103
Traes_2BL_754076A48.1	Triticum aestivum	95.9	146	1e-96
Traes_2AL_34786C78C.1	Triticum aestivum	93	143	5e-87
Brast09G124700.1.p	Brachypodium stacei	79	143	1e-72
Sevir.7G153400.1.p	Setaria viridis	75.2	145	2e-71
ONIVA04G14830.1	Oryza nivara	77.2	145	2e-70
OMERI04G14070.1	Oryza meridionalis	76.5	145	1e-69
OGLUM04G16740.1	Oryza glumaepatula	76.5	145	1e-69
LOC_Os04g41030.1	Oryza sativa	76.5	145	2e-69

Showing 1 to 10 of 499 entries

Protein sequence

MSPLLLLLALALPLALATPGSASETQEDDESRVLGLSLAGFGLQGTVPSALKYCRSTNILDLSKNALEGP
IPPALCDWLPFLVILDLSGNRFSGPLPSELANCRYLNSLKLSHNNFSGQIPASLSRLERLKSLDLSENRL
DGQIPPQLSATFPKESFSGNPGLCGRPVSSHCGRD