DCAR_004121 (PRGDB2172790)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2172790	DCAR_004121	T	putative	TIR	Daucus carota

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
orange1.1g046164m	Citrus sinensis	64.5	189	2e-88
Ciclev10018304m	Citrus clementina	64.5	189	4e-88
Potri.004G038200.1	Populus trichocarpa	63.6	187	3e-87
VIT_00s0375g00020.t01	Vitis vinifera	67.6	182	3e-86
Thecc1EG029929t1	Theobroma cacao	62.8	188	2e-85
Solyc02g078680.1.1	Solanum lycopersicum	66.1	186	4e-85
Prupe.4G041100.1.p	Prunus persica	72.2	158	1e-84
Manes.15G084900.1.p	Manihot esculenta	64	175	1e-84
Manes.17G042000.1.p	Manihot esculenta	72.3	155	3e-84
MDP0000178596	Malus domestica	71.3	157	1e-83

Showing 1 to 10 of 499 entries

Protein sequence

MQHYSSSTCKNICNRILHHRNQLRPTIGGPSSPCDIFISHRGIDTKDNVAGLLYDHLSRLGFRPFLDSKN
MKPGDKLFDKIDTAVRQCKLGISVLSPRYCDSYFCLHELSLIMESNKKFIPIFVDVKPSELRVRDNGCCT
AENLKRFSWALQEAKYTVGLTFNTSKGNWSEFLMDASDAVMKNLLEVKD