Carubv10019470m (PRGDB220287)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB220287	Carubv10019470m	T	putative	TM, TIR	Capsella rubella

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Carubv10019321m	Capsella rubella	82.8	169	2e-98
Carubv10019542m	Capsella rubella	70.5	166	4e-76
Araha.49972s0001.1.p	Arabidopsis halleri	67.5	169	3e-74
Araha.13567s0001.1.p	Arabidopsis halleri	69.8	169	8e-74
Carubv10019041m	Capsella rubella	69.9	166	8e-73
864783	Arabidopsis lyrata	68.6	169	1e-72
AT2G03300.1	Arabidopsis thaliana	69.2	169	1e-71
Bostr.0556s0151.1.p	Babiana stricta	62.4	178	6e-69
Cagra.6207s0001.1.p	Conradina grandiflora	70.5	156	1e-67
Bostr.11774s0003.1.p	Babiana stricta	61.8	178	6e-67

Showing 1 to 10 of 499 entries

Protein sequence

MTIISLSQAHKVFLNYRGEQLRYSFVSHLIDAFERTKINFFVDNYEQRGNDHKISLIEESRIALAIFSTR
VTRRFKNRNHTRLKYMYAESSWCMDELVKIKKLADKEKLQVIPIFYMVKAREVRNQTGEFGDNFWIIAKY
STGDQIKKWKEALECIADKMGLSLRAKRCFPLTLMTLVLLCSTLSL