Cagra.21829s0001.1.p (PRGDB225306)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB225306	Cagra.21829s0001.1.p	T	putative	TIR	Conradina grandiflora

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Cagra.7993s0003.1.p	Conradina grandiflora	82.8	116	2e-58
AT1G63860.1	Arabidopsis thaliana	80.9	115	2e-54
AT1G63860.2	Arabidopsis thaliana	80.9	115	2e-54
AT1G63870.1	Arabidopsis thaliana	78.5	116	3e-54
Bo00787s070.1	Brassica oleracea	76.4	106	1e-53
Bo9g034090.1	Brassica oleracea	68.1	113	2e-52
Bo9g029510.1	Brassica oleracea	66.7	114	2e-52
875511	Arabidopsis lyrata	75.9	116	8e-52
AT1G63880.1	Arabidopsis thaliana	77.7	112	1e-51
Bostr.29223s0035.1.p	Babiana stricta	69.6	112	2e-51

Showing 1 to 10 of 499 entries

Protein sequence

MSLMITSPNVFPSPNYKFDVFASFHGPDVRKTLLSHMRKQFDFNGIAMFDDQGIERSKEIAPSLKKAIKE
SRISILILSKKYASSSWCLDELVEILNCKKAFEQILMTIFYGVEPSH