Bo9g029510.1 (PRGDB219904)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB219904	Bo9g029510.1	T	putative	TIR	Brassica oleracea

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.25586s0003.1.p	Arabidopsis halleri	81.6	152	9e-88
Bostr.8169s0028.1.p	Babiana stricta	80.5	159	2e-86
875523	Arabidopsis lyrata	81.9	160	3e-83
Cagra.1531s0001.1.p	Conradina grandiflora	77.7	157	4e-83
875509	Arabidopsis lyrata	81.7	158	3e-82
Bostr.30057s0091.2.p	Babiana stricta	79.1	158	4e-82
Bostr.30057s0091.3.p	Babiana stricta	79.1	158	4e-82
Bo00787s070.1	Brassica oleracea	71	162	8e-82
AT1G63730.1	Arabidopsis thaliana	81.9	160	1e-81
Bostr.29223s0162.1.p	Babiana stricta	82.3	158	1e-81

Showing 1 to 10 of 499 entries

Protein sequence

MASSSSYLPRTWRYGVFTSFHGPDVRKTFLSHLRKQFNRNGITMFNDQGIEKSQTIAPALTQAISESRIS
IVVLSKNYASSSWCLDELVEILKCKEEIGQIVMTVFYGVDPSHVRKQTGEFGEVFSETCARKQEDRRLIW
NQALNDVGNIAGEHFLNWVKLAGRTGK