Cagra.6368s0001.1.p (PRGDB225324)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB225324	Cagra.6368s0001.1.p	TN	putative	NBS, TM, TIR	Conradina grandiflora

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Bostr.10273s0060.1.p	Babiana stricta	48.9	229	5e-61
Cagra.6368s0004.1.p	Conradina grandiflora	81.7	104	7e-53
Bostr.10273s0061.1.p	Babiana stricta	45.8	225	2e-50
Bostr.10273s0063.1.p	Babiana stricta	47.3	205	9e-50
877391	Arabidopsis lyrata	44.5	220	6e-48
Cagra.28063s0001.1.p	Conradina grandiflora	43.7	222	5e-46
Cagra.24531s0001.1.p	Conradina grandiflora	40.4	228	1e-42
877393	Arabidopsis lyrata	62.6	115	1e-41
AT1G72920.1	Arabidopsis thaliana	66.1	109	2e-41
877392	Arabidopsis lyrata	63.4	112	3e-41

Showing 1 to 10 of 499 entries

Protein sequence

MSETEVTLQKFDVFLSFNGDDTGRNFISFLNTELIKKNVKIPPFKYDRQISPELERISPELERAIGGSRF
AVVVVSENYSASPWCLEELVKVMDIVRKGSITVIPVFYGVDPCHLISKNLMIDTTRINGSDLQGIYAHMK
AFNRLLNLSSKKSVRVIGIWERGSKKRSVLAK