Eucgr.C01949.1.p (PRGDB228564)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228564	Eucgr.C01949.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.C01656.1.p	Eucalyptus grandis	98.5	69	3e-43
Eucgr.C01970.1.p	Eucalyptus grandis	64	86	1e-31
Eucgr.C01968.1.p	Eucalyptus grandis	58.6	70	1e-20
Eucgr.F04311.1.p	Eucalyptus grandis	58.6	70	9e-20
Eucgr.C01654.1.p	Eucalyptus grandis	60	70	1e-19
Eucgr.C02630.1.p	Eucalyptus grandis	58.6	70	2e-19
Eucgr.L03438.1.p	Eucalyptus grandis	61.2	67	3e-19
Eucgr.J02084.1.p	Eucalyptus grandis	56.1	66	1e-15
Eucgr.H02359.1.p	Eucalyptus grandis	53.3	60	5e-14
Eucgr.C02558.1.p	Eucalyptus grandis	44.8	67	1e-13

Showing 1 to 10 of 499 entries

Protein sequence

MMKRRKSHGLEVKPIFYDVEPSVVKLEPGVYREALIQHEKERGAETVQGWKEALKEVTEIAGWKAENTGY
VNSLNSSFHFLSVSYA