Eucgr.C01656.1.p (PRGDB228565)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228565	Eucgr.C01656.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.C01949.1.p	Eucalyptus grandis	98.5	69	5e-43
Eucgr.C01970.1.p	Eucalyptus grandis	62.3	69	1e-20
Eucgr.C01968.1.p	Eucalyptus grandis	59.4	69	1e-18
Eucgr.C01654.1.p	Eucalyptus grandis	56.6	76	2e-18
Eucgr.L03438.1.p	Eucalyptus grandis	61.2	67	3e-18
Eucgr.F04311.1.p	Eucalyptus grandis	49.4	83	7e-18
Eucgr.C02630.1.p	Eucalyptus grandis	58	69	2e-17
Eucgr.J02084.1.p	Eucalyptus grandis	47.3	93	2e-15
Eucgr.D01599.2.p	Eucalyptus grandis	41.4	70	2e-13
Eucgr.D01599.1.p	Eucalyptus grandis	41.4	70	2e-13

Showing 1 to 10 of 499 entries

Protein sequence

MMKRRKSHGLEVKPIFYDVEPSVVKLEPGVYREALIQHENERGAETVQGWKEALKEVTEIAGWKAENTGK
FAAKKFPIQKLQVVGGSRQKVLGCVCKRKNWLASSPSLSSQLLGQWNNATPEEYREKQEICFKA