Eucgr.D00984.1.p (PRGDB228566)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228566	Eucgr.D00984.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.D00988.1.p	Eucalyptus grandis	64	86	6e-28
Eucgr.D00069.1.p	Eucalyptus grandis	41.4	87	9e-10
Eucgr.D00769.2.p	Eucalyptus grandis	40	90	2e-8
Eucgr.D00769.1.p	Eucalyptus grandis	40	90	2e-8
Eucgr.C01481.1.p	Eucalyptus grandis	34.8	89	3e-8
Eucgr.D00989.1.p	Eucalyptus grandis	38.6	88	7e-8
Eucgr.E01685.1.p	Eucalyptus grandis	35.5	93	2e-7
Eucgr.E01683.1.p	Eucalyptus grandis	30.8	91	6e-7
Eucgr.C02654.1.p	Eucalyptus grandis	31.1	90	8e-7

Showing 1 to 9 of 9 entries

Protein sequence

MFKCVEKKGQNILPIFYGVKPSQEKKLRRFWMDMLRHKVPQETCQRLLESVNWVWSIGGFVSENIGNGDK
GELVEVVFQQVIKLMRTRSCRSWSIPIDSETNPATAKVAKEPLIVF