Eucgr.D00988.1.p (PRGDB228582)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228582	Eucgr.D00988.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.D00069.1.p	Eucalyptus grandis	43	214	3e-43
Eucgr.D01450.1.p	Eucalyptus grandis	39.8	211	2e-38
Eucgr.D00998.1.p	Eucalyptus grandis	45.1	164	6e-37
Eucgr.D00989.1.p	Eucalyptus grandis	38.8	206	3e-35
Eucgr.D00065.1.p	Eucalyptus grandis	39.7	156	2e-28
Eucgr.D00984.1.p	Eucalyptus grandis	64	86	1e-27
Eucgr.D00769.2.p	Eucalyptus grandis	34.9	212	2e-25
Eucgr.D00769.1.p	Eucalyptus grandis	34.9	212	2e-25
Eucgr.C02654.1.p	Eucalyptus grandis	35.7	157	1e-22
Eucgr.D01447.1.p	Eucalyptus grandis	38.6	158	1e-21

Showing 1 to 10 of 499 entries

Protein sequence

MVVEKVSSILSPPWIEQIPMFRKKRKKSKCEVFPLSSPATKKTFASHLPYHLERENISVFRDDDQYLIGK
DVDREVRNAMDHCKIFIPIISEDFASSHDCLDKLVQMFKCVEENGQKILPVFYEVDLSRKKELRDHFWTD
MLRHDVPGETRQRWLESFDRVFSIAGFVSENFGNGGELADVVRQHVIRLIADLKL