Eucgr.C01604.1.p (PRGDB228569)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228569	Eucgr.C01604.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.E03511.2.p	Eucalyptus grandis	96.8	190	1e-133
Eucgr.E03511.1.p	Eucalyptus grandis	96.8	190	1e-133
Eucgr.C01356.1.p	Eucalyptus grandis	41.8	194	3e-31
Eucgr.C01422.1.p	Eucalyptus grandis	40.4	198	4e-28
Eucgr.C00409.1.p	Eucalyptus grandis	39.6	164	3e-22
Potri.T003000.2	Populus trichocarpa	37.3	161	1e-20
Potri.T112700.2	Populus trichocarpa	39	159	2e-20
Potri.T002100.1	Populus trichocarpa	34.7	196	4e-20
Potri.T112700.1	Populus trichocarpa	39	159	5e-20
Potri.019G052000.1	Populus trichocarpa	37.7	159	1e-19

Showing 1 to 10 of 499 entries

Protein sequence

MERKEPTPSEDPTHGASSSSTSPHRGDSGGGRQKPKGNDRDVFLSSVCPMWSTLFDDLRHGLVIAGIDTF
CSKDNADEWIPYNLPQCKISIPIFERGFVNDKSGLRELVHMWKCKRSSGQIVLPIFDEVGPLEVQLLEGE
SIEEFSRLEGRVDEMELGEWRKALAEVGSLRGWEAEKFAYGYIICHRNII