Eucgr.E03511.2.p (PRGDB228570)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228570	Eucgr.E03511.2.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.E03511.1.p	Eucalyptus grandis	99.9	190	4e-139
Eucgr.C01604.1.p	Eucalyptus grandis	96.8	190	1e-133
Eucgr.C01356.1.p	Eucalyptus grandis	42.3	194	8e-33
Eucgr.C01422.1.p	Eucalyptus grandis	40.4	198	4e-29
Eucgr.C00409.1.p	Eucalyptus grandis	36.6	164	3e-22
Potri.T003000.2	Populus trichocarpa	36.4	173	3e-21
Potri.T112700.2	Populus trichocarpa	39.1	151	1e-20
Potri.T002100.1	Populus trichocarpa	34.2	199	2e-20
Potri.019G052000.1	Populus trichocarpa	37.6	157	3e-20
Potri.T112700.1	Populus trichocarpa	39.1	151	3e-20

Showing 1 to 10 of 499 entries

Protein sequence

MERKEPTPSEDPMHGASTSSTSPHGGDSGGGTQKPKGNDHDVFLSSVCPMWSTLFDDLRHGLVIAGIDTF
CSKDNADEWIPYVLPQCKISIPIFERGFVNDKSGLRELVHMWKCKRSSGQIVLPIFDEVGPLEVQLLEGE
SIEEFSRLEGRVDEMELGEWRKALAEVGSLRGWEAEKFAYGYIICHRNII