Eucgr.C02994.1.p (PRGDB228575)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228575	Eucgr.C02994.1.p	T	putative	TM, TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.L01982.1.p	Eucalyptus grandis	49.3	148	3e-41
Eucgr.D01601.1.p	Eucalyptus grandis	48.4	155	5e-37
Eucgr.H02359.1.p	Eucalyptus grandis	46.2	158	3e-36
Eucgr.K01937.1.p	Eucalyptus grandis	48.5	161	1e-35
Eucgr.C03974.1.p	Eucalyptus grandis	47.3	146	3e-35
Eucgr.F03897.1.p	Eucalyptus grandis	46.5	144	4e-35
Eucgr.F03896.1.p	Eucalyptus grandis	43.1	181	5e-35
Eucgr.F03913.1.p	Eucalyptus grandis	43.2	176	2e-34
Eucgr.C02558.1.p	Eucalyptus grandis	44.9	156	2e-34
Eucgr.F03914.1.p	Eucalyptus grandis	46.1	156	7e-34

Showing 1 to 10 of 499 entries

Protein sequence

MANSEDGSSSDASRASRGEYQVFLNFKGPNTHHGFIDFLYHGLVDAGVHVLRDGDELCIGEVIGGILLRA
INNSTIYILIFFWTYTSSKWCPCEFAHIVNNTSKSEGKKSIILIFLDVEREDVKLKTPQYSDTLLEHTSK
FPDEVKAWRKALAEVDEIKEWNVERTKVGPCMKDKRQCGTLCGNYNIKGCC