Eucgr.B02963.1.p (PRGDB228581)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228581	Eucgr.B02963.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.F03913.1.p	Eucalyptus grandis	57.1	56	2e-13
Eucgr.F03896.1.p	Eucalyptus grandis	55.4	56	3e-13
Eucgr.F03914.1.p	Eucalyptus grandis	55.4	56	5e-13
Eucgr.C01970.1.p	Eucalyptus grandis	48.2	56	2e-12
Eucgr.F03897.1.p	Eucalyptus grandis	51.8	56	5e-12
Eucgr.C03974.1.p	Eucalyptus grandis	51.8	56	7e-12
Eucgr.L02872.1.p	Eucalyptus grandis	53.6	56	8e-12
Eucgr.F02533.1.p	Eucalyptus grandis	53.6	56	9e-12
Eucgr.K01937.1.p	Eucalyptus grandis	55.4	56	1e-11
Eucgr.D02660.1.p	Eucalyptus grandis	50	56	1e-11

Showing 1 to 10 of 425 entries

Protein sequence

MSSSFRGSDRCLNFTDYFYHSMVCAGLCVFLDSEELKDGEKISEVLKAVNESRICIPISLKTSLFSS