Eucgr.H02209.1.p (PRGDB228588)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228588	Eucgr.H02209.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.H01829.1.p	Eucalyptus grandis	63.3	79	9e-28
Eucgr.H01803.1.p	Eucalyptus grandis	64.6	79	2e-27
Eucgr.H01894.1.p	Eucalyptus grandis	63.3	79	5e-27
Eucgr.H01772.1.p	Eucalyptus grandis	60.8	79	6e-26
Eucgr.H02123.1.p	Eucalyptus grandis	63.3	79	1e-25
Eucgr.H01806.1.p	Eucalyptus grandis	55.7	79	5e-24
Eucgr.H02187.1.p	Eucalyptus grandis	63.3	79	6e-24
Eucgr.H01794.1.p	Eucalyptus grandis	54.4	79	2e-23
Eucgr.H01900.1.p	Eucalyptus grandis	54.4	79	3e-21
Eucgr.H02169.1.p	Eucalyptus grandis	53.2	79	2e-20

Showing 1 to 10 of 499 entries

Protein sequence

MSSSSSEAKWPYDIILKLQRRGVCHGFLASLHRAMLHGGINAYIDSEDLRPGNNISLVLTKAIVEGQITV
LIFSKNYTSSWQCLDADEGNVV