Eucgr.E01850.1.p (PRGDB228596)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228596	Eucgr.E01850.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.E01799.1.p	Eucalyptus grandis	87.4	95	9e-54
Eucgr.E01866.1.p	Eucalyptus grandis	78.4	102	4e-50
Eucgr.E01863.1.p	Eucalyptus grandis	86.5	96	2e-49
Eucgr.E01861.1.p	Eucalyptus grandis	80.4	102	3e-49
Eucgr.E01810.1.p	Eucalyptus grandis	77.5	102	9e-46
Eucgr.E01836.1.p	Eucalyptus grandis	79.6	93	1e-42
Eucgr.E01803.1.p	Eucalyptus grandis	74.7	95	4e-40
Eucgr.E01804.1.p	Eucalyptus grandis	75.3	93	4e-40
Eucgr.H03845.1.p	Eucalyptus grandis	70.5	88	2e-37
Eucgr.J01308.1.p	Eucalyptus grandis	69.9	93	6e-37

Showing 1 to 10 of 499 entries

Protein sequence

MWNASSDNQEMKKSSEYDYEVFLSFRGPYTRTDIADYLYVSMIDVGIRAYRDYEELCTGEEISGQLLQAI
QHSKISIPIFSKGYANSPWCLRDLVKMVESKNIGG