Eucgr.D00063.1.p (PRGDB228598)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228598	Eucgr.D00063.1.p	T	putative	TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.D00769.2.p	Eucalyptus grandis	67.2	192	1e-78
Eucgr.D00769.1.p	Eucalyptus grandis	67.2	192	1e-78
Eucgr.D00991.1.p	Eucalyptus grandis	65.1	169	2e-70
Eucgr.D01447.3.p	Eucalyptus grandis	53.2	173	9e-57
Eucgr.D01447.2.p	Eucalyptus grandis	53.2	173	9e-57
Eucgr.D01447.1.p	Eucalyptus grandis	53.2	173	3e-56
Eucgr.C01356.1.p	Eucalyptus grandis	45.2	177	6e-46
Eucgr.D02396.1.p	Eucalyptus grandis	51	153	1e-43
Eucgr.C01724.1.p	Eucalyptus grandis	53.5	155	4e-43
Eucgr.C02111.1.p	Eucalyptus grandis	47.1	155	1e-42

Showing 1 to 10 of 499 entries

Protein sequence

MKRKASYRLATVPPPVPLSVYACKALQGKRCAVAWNYDVFLNIRGPDTRTGFVDFLYNSLVAARVHVFRD
NDVLPVGEEIGPELLWAIRSCRIAIPIISEQYAQSKWCLRELNEIMDCHVELGISVFPVFYKVDVVDVRR
RSGKFGEALSKQEKQGRREEVLRWKYALSFVASIREWISQAIANGHEG