Eucgr.D00991.1.p (PRGDB228611)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228611	Eucgr.D00991.1.p	T	putative	TM, TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.D00063.1.p	Eucalyptus grandis	65.1	169	2e-70
Eucgr.D00769.2.p	Eucalyptus grandis	57.3	185	9e-61
Eucgr.D00769.1.p	Eucalyptus grandis	57.3	185	9e-61
Eucgr.D01447.3.p	Eucalyptus grandis	54.2	179	2e-60
Eucgr.D01447.2.p	Eucalyptus grandis	54.2	179	2e-60
Eucgr.D01447.1.p	Eucalyptus grandis	54.2	179	4e-60
Eucgr.L02320.1.p	Eucalyptus grandis	55.7	158	4e-49
Eucgr.C01724.1.p	Eucalyptus grandis	54.8	166	3e-48
Eucgr.D00989.1.p	Eucalyptus grandis	54.5	156	2e-44
Eucgr.D02396.1.p	Eucalyptus grandis	52	152	3e-44

Showing 1 to 10 of 499 entries

Protein sequence

MYAFANVLLALLLIYACKIVPKKTGAVPQNYDVFLSFRGEDTRTGFTDFLYISLVDAGFHVFRDNDALPV
GKEIGSELLQAIRNCQIAIPIISERYAQSKPCLHELNEIMDCHTKHRKSVFPVFYKVDVVDVLEQRGIFG
KALREHRRHCSSRDVQNWELALTSVAGIRGWTSQAIANGYVYQNPNLPALGGK