Eucgr.H03821.1.p (PRGDB228602)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB228602	Eucgr.H03821.1.p	T	putative	TM, TIR	Eucalyptus grandis

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Eucgr.H03809.1.p	Eucalyptus grandis	75.9	116	2e-53
Eucgr.H03845.1.p	Eucalyptus grandis	68.1	116	1e-52
Eucgr.H03529.1.p	Eucalyptus grandis	66.4	116	1e-51
Eucgr.H03826.1.p	Eucalyptus grandis	67.2	116	7e-50
Eucgr.H03815.1.p	Eucalyptus grandis	76.8	99	9e-50
Eucgr.C01920.1.p	Eucalyptus grandis	67.2	116	2e-48
Eucgr.H03694.1.p	Eucalyptus grandis	69	116	7e-48
Eucgr.H03750.1.p	Eucalyptus grandis	68.1	116	2e-47
Eucgr.C01912.1.p	Eucalyptus grandis	68.7	115	3e-47
Eucgr.H03796.1.p	Eucalyptus grandis	65.5	116	4e-46

Showing 1 to 10 of 499 entries

Protein sequence

FLSFRGPDTRAGFTDHLYTRLNDAGVHTFKDDEELCIGEGFTSELLQAIKRWKILIPIFPKGYASSIWCL
KGLVQMVKCRKNERQKIMPIFYSVAPSEVQHQIGGYAKTFRSHEKK